Model Card for SynCodonLM


Installation

git clone https://github.com/Boehringer-Ingelheim/SynCodonLM.git
cd SynCodonLM
pip install -r requirements.txt #maybe not neccesary depending on your env :)

Usage

SynCodonLM uses token-type ID's to add species-specific codon sontext to it's thinking.

Before use, find the token type ID (species_token_type) for your species of interest here!
Or use our list of model organisms below

Embedding a Coding DNA Sequence

from SynCodonLM import CodonEmbeddings

model = CodonEmbeddings() #this loads the model & tokenizer using our built-in functions

seq = 'ATGTCCACCGGGCGGTGA'

mean_pooled_embedding = model.get_mean_embedding(seq, species_token_type=67) #E. coli
#returns --> tensor of shape [768]

raw_output = model.get_raw_embeddings(seq, species_token_type=67) #E. coli
raw_embedding_final_layer = raw_output.hidden_states[-1] #treat this like a typical Hugging Face model dictionary based output!
#returns --> tensor of shape [batch size (1), sequence length, 768]

Codon Optimizing a Protein Sequence

This has not yet been rigourosly evaluated, although we can confidently say it will generate 'natural looking' coding-DNA sequences.
from SynCodonLM import CodonOptimizer

optimizer = CodonOptimizer() #this loads the model & tokenizer using our built-in functions

result = optimizer.optimize(
    protein_sequence="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK", #GFP 
    species_token_type=67, #E. coli
    deterministic=True #true by default
)
codon_optimized_sequence = result.sequence

Citation

If you use this work, please cite:

@article {Heuschkel2025.08.19.671089,
    author = {Heuschkel, James and Kingsley, Laura and Pefaur, Noah and Nixon, Andrew and Cramer, Steven},
    title = {Advancing Codon Language Modeling with Synonymous Codon Constrained Masking},
    elocation-id = {2025.08.19.671089},
    year = {2025},
    doi = {10.1101/2025.08.19.671089},
    publisher = {Cold Spring Harbor Laboratory},
    abstract = {Codon language models offer a promising framework for modeling protein-coding DNA sequences, yet current approaches often conflate codon usage with amino acid semantics, limiting their ability to capture DNA-level biology. We introduce SynCodonLM, a codon language model that enforces a biologically grounded constraint: masked codons are only predicted from synonymous options, guided by the known protein sequence. This design disentangles codon-level from protein-level semantics, enabling the model to learn nucleotide-specific patterns. The constraint is implemented by masking non-synonymous codons from the prediction space prior to softmax. Unlike existing models, which cluster codons by amino acid identity, SynCodonLM clusters by nucleotide properties, revealing structure aligned with DNA-level biology. Furthermore, SynCodonLM outperforms existing models on 6 of 7 benchmarks sensitive to DNA-level features, including mRNA and protein expression. Our approach advances domain-specific representation learning and opens avenues for sequence design in synthetic biology, as well as deeper insights into diverse bioprocesses.Competing Interest StatementThe authors have declared no competing interest.},
    URL = {https://www.biorxiv.org/content/early/2025/08/24/2025.08.19.671089},
    eprint = {https://www.biorxiv.org/content/early/2025/08/24/2025.08.19.671089.full.pdf},
    journal = {bioRxiv}
}

Model Organisms Species Token Type IDs

Organism Token-Type ID
E. coli 67
S. cerevisiae 108
C. elegans 187
D. melanogaster 178
D. rerio 468
M. musculus 321
A. thaliana 266
H. sapiens 317
C. griseus 394
Downloads last month
31
Safetensors
Model size
0.1B params
Tensor type
F32
·
Inference Providers NEW
This model isn't deployed by any Inference Provider. 🙋 Ask for provider support

Dataset used to train jheuschkel/SynCodonLM

Collection including jheuschkel/SynCodonLM